PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00009g00621.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 310aa    MW: 34438.3 Da    PI: 4.9346
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00009g00621.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.82.6e-131759246
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
           Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                              +++T++E+el++++++  G++ W+ Ia+ ++ g+t++++k+ w++
  Peaxi162Scf00009g00621.1 17 DNFTPQEEELIIKLHATIGSR-WSIIAQQLP-GKTDNDVKNLWNT 59
                              58*******************.*********.**********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-4423IPR009057Homeodomain-like
SuperFamilySSF466891.4E-16569IPR009057Homeodomain-like
PROSITE profilePS5129420.0451165IPR017930Myb domain
SMARTSM007173.3E-111563IPR001005SANT/Myb domain
PfamPF002493.9E-121859IPR001005SANT/Myb domain
CDDcd001674.37E-91861No hitNo description
Gene3DG3DSA:1.10.10.602.8E-182462IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
SQKVRWSNRL KPDLKEDNFT PQEEELIIKL HATIGSRWSI IAQQLPGKTD NDVKNLWNTK  60
LKKKLSAMGI DPVTHKPFSQ ILTDYGNIGG FPKARTHFVS LNRELKGAFM SRPEQFQHPL  120
EIFSNFNSHC LTTIKLPKAE ASEDCFLSNT NDSSNNQPPV DLLTELQAIK FVTDASNYSS  180
PKAIFSRSNP INDYSSSPLS SSSSSSASHS LSKTQVERAS PGLNWCDYLL DDAFIPSNFQ  240
VQEDTLTIED KLASGAAQDG QSNMPSMKDS ETSLSTRGAS SSSSSFVEDM LECENEMFLN  300
FPGLSEDPFY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-1456548108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009631987.11e-162PREDICTED: myb-related protein 315
TrEMBLK4BKK51e-160K4BKK5_SOLLC; Uncharacterized protein
STRINGSolyc03g113530.2.11e-159(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA123481922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.13e-29MYB family protein